Panda means: Algospeak for "police." Used in TikTok captions and comments to discuss law enforcement without triggering content restrictions.. It is internet-era slang, commonly seen on TikTok, Discord, Reddit or X. There is no real cause for parental concern; it is descriptive vocabulary rather than risky behaviour. If your teen uses it, context will usually make the intent clear. A short, curious question about where they heard it is usually all that is needed to know whether to follow up.
panda
Algospeak for "police." Used in TikTok captions and comments to discuss law enforcement without triggering content restrictions.
Seen in the wild
5 citations · last seen May 2026
Etymology timeline
Born ~2020 · 1 year of recorded useSeen in the wild
BlueskyMay 2026
@panda die Farbe sieht noch besser aus als gedacht. Gefällt mir. Viel Freude damit und allzeit gute Fahrt!
View source
BlueskyMay 2026
Loud Panda for one hundred years!
View source
BlueskyMay 2026
Being stuck anywhere with a Red Panda is a pleasant experience! 🥰
View source
BlueskyMay 2026
Open-world RPG Neverness to Everness fully leans into Initial D references with familiar tofu shop, panda Trueno and mountain drifting automaton-media.com/en/news/open...
View source
BlueskyMay 2026
Ankit Kumar Panda, Rajesh Biswas: Relativistic BDNK MHD Evolution in a Boost-Invariant Medium and Its Impact on Dilepton Production https://arxiv.org/abs/2605.01807 https://arxiv.org/pdf/2605.01807 https://arxiv.org/h…
View source
Definitions
#1·Apr 26, 2026
Algospeak for "police." Used in TikTok captions and comments to discuss law enforcement without triggering content restrictions.
"The pandas showed up at the protest."
Origin: TikTok activism content from the early 2020s.
For parents
Panda means: Algospeak for "police." Used in TikTok captions and comments to discuss law enforcement without triggering content restrictions.. It is internet-era slang, commonly seen on TikTok, Discord, Reddit or X. There is no real cause for parental concern; it is descriptive vocabulary rather than risky behaviour. If your teen uses it, context will usually make the intent clear. A short, curious question about where they heard it is usually all that is needed to know whether to follow up.
For ESL learners
panda means: Algospeak for "police." Used in TikTok captions and comments to discuss law enforcement without triggering content restrictions.. Register: very informal, internet slang. Standard in its technical domain but rare in everyday talk; gloss with a plain synonym when writing for a general audience. A common learner mistake is using the word in a register it does not fit, or assuming a single global meaning; native speakers immediately notice when slang appears in formal contexts, so always check the surrounding register before producing it yourself.
Cluster: social_media
Heard in the wild
“@panda die Farbe sieht noch besser aus als gedacht. Gefällt mir. Viel Freude damit und allzeit gute Fahrt!”
— Bluesky· May 2026“Loud Panda for one hundred years!”
— Bluesky· May 2026“Being stuck anywhere with a Red Panda is a pleasant experience! 🥰”
— Bluesky· May 2026“Open-world RPG Neverness to Everness fully leans into Initial D references with familiar tofu shop, panda Trueno and mountain drifting automaton-media.com/en/news/open...”
— Bluesky· May 2026“Ankit Kumar Panda, Rajesh Biswas: Relativistic BDNK MHD Evolution in a Boost-Invariant Medium and Its Impact on Dilepton Production https://arxiv.org/abs/2605.01807 https://arxiv.org/pdf/2605.01807 https://arxiv.org/html/2605.01807”
— Bluesky· May 2026
Was this helpful?
Comments
#3·May 2, 2026
A brahmin who acts as the hereditary superintendent of a particular ghat or temple, and is regarded as knowledgeable in matters of genealogy and ritual.
Source: Wiktionary (CC BY-SA 4.0)
Was this helpful?
Comments
Show 2 more dictionary-style senses (imported)
#4·May 2, 2026
The red panda (), a small raccoon-like animal of northeast Asia with reddish fur and a long, ringed tail.
Source: Wiktionary (CC BY-SA 4.0)
Was this helpful?
Comments
For specific readers
Why is this section here?
Slang is read by different audiences for very different reasons. The For parents view re-explains the term in plain, non-judgemental language so a caregiver can understand what their child means without needing the surrounding subculture. The For English learners view focuses on register (when it's safe to use), formal alternatives, and common mistakes — what a textbook won't teach you.
Have a better definition?
Add your own interpretation of "panda".
🌐About Internet & Memes slang
Viral internet speak — memes, ratios, main-character moments, and the algospeak of every platform from Twitter to Reddit to TikTok comment sections.
See all Internet & Memes slang on Slangora.
Tags
Other words near "panda" (P)
pancake turnerpanchayatpancheonpanchnamapanchwaypancrackpanda carpanda dolphinpanda energypanda modepandanus palmpandit
Browse all slang words starting with P.
Related terms
People also read
Semantically related
- panda car67%
(UK, Irish, law enforcement, informal) A police car; specifically (historical), one with a broad white stripe painted around its middle on a darker-coloured or, originally, black background.
- algospeak63%
The system of coded language used to evade content moderation algorithms. Examples: unalive, seggs, le dollar bean, panda, spicy.
- pawlice62%
(Internet slang, humorous) An imaginary police force relating to, or staffed by, animals.
- seggs61%
Algospeak respelling of "sex," used to evade content moderation on TikTok and other platforms.
- Twit-Tok60%
(internet slang, derogatory) The social media platform TikTok.